PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02131g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 649aa    MW: 71743.4 Da    PI: 6.7247
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02131g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.52.2e-22115215198
                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                               f k+lt+sd+++ g +++p+ +a+ +         ++ +  tl  +d +g++W++++iyr++++r++lt+GW  Fv++++L +gD
  Niben101Scf02131g00001.1 115 FAKTLTQSDANNGGGFSVPRYCADMIfprldhsADPPVQ--TLLAKDVHGKTWKFRHIYRGTPRRHLLTTGWTTFVDSKKLIAGD 197
                               89*********************999****985444444..8999**************************************** PP

                               EEEEEE-SSSEE..EEEEE- CS
                        B3  79 fvvFkldgrsefelvvkvfr 98 
                               ++vF   + +++  +v+++r
  Niben101Scf02131g00001.1 198 SIVFV--RAENGDVCVGIRR 215
                               *****..34788889*9998 PP

2Auxin_resp104.21.5e-34260342183
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               aa+ a+++++Fev+++Prast+eF vk+++ve+al+++++ GmRfkmafe++ds    ++Gt+ +v+ +dp+rWp+S+Wr+L+
  Niben101Scf02131g00001.1 260 AANLAASGQPFEVTFYPRASTPEFFVKASRVEAALQIRWCSGMRFKMAFENKDSTMSWFMGTICSVQVADPIRWPDSPWRLLQ 342
                               7899****************************************************999**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.2E-35106217IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-28108216IPR015300DNA-binding pseudobarrel domain
CDDcd100173.62E-19114215No hitNo description
PROSITE profilePS5086312.887115217IPR003340B3 DNA binding domain
SMARTSM010193.4E-21115217IPR003340B3 DNA binding domain
PfamPF023622.7E-20115215IPR003340B3 DNA binding domain
PfamPF065071.6E-29260342IPR010525Auxin response factor
PROSITE profilePS5174512.986558638IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MNTFMEEEDK WLDSKFWHAC AGNMVELPAA NSIVFYFPQG HAEHVCGNVE FRSEIRIPSY  60
IPCRVSGIKY MADQENDEVF AKIRLTPVSI NEVEIADDGV VAKSGSDNKD KPASFAKTLT  120
QSDANNGGGF SVPRYCADMI FPRLDHSADP PVQTLLAKDV HGKTWKFRHI YRGTPRRHLL  180
TTGWTTFVDS KKLIAGDSIV FVRAENGDVC VGIRRVKKGI AGGHDTPFTV PYGGFSAFLR  240
HDENKLMKRG KVKVESVIEA ANLAASGQPF EVTFYPRAST PEFFVKASRV EAALQIRWCS  300
GMRFKMAFEN KDSTMSWFMG TICSVQVADP IRWPDSPWRL LQVTWDEPDL LQHVKCVNPW  360
LVELVSDMPT IHFSPPSSPQ KKPRLLQRSD FPLNCHLPML GFPDNHFLPN DTPAGMQGAR  420
HTQYGFSLSD LHLNKLHASP FPVGFPPPDH AAATPSPSNS TLTPKPSSSN DMSCLLTLGT  480
STETVTKSDC DKAPQLVLFG QPIFTEQQIS LSSSADMVSP VCARTSSSDG NADKIGNISD  540
ESASTFDHRG LSEQNVEIGH CKVFIESKDV GQTLDLSVLG SYEALQKKLS DIFGIKMPEM  600
LNRVLYRDIT GAVKQLGDEP FSDFVKTARR LTILTDTSSV GALGSRENQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A3e-791236351388Auxin response factor 5
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803255.10.0PREDICTED: auxin response factor 18-like
RefseqXP_009803256.10.0PREDICTED: auxin response factor 18-like
SwissprotQ653H70.0ARFR_ORYSJ; Auxin response factor 18
TrEMBLK4CQH00.0K4CQH0_SOLLC; Auxin response factor
STRINGSolyc09g007810.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59224115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.10.0auxin response factor 16